We’ve is Tapped Into A Goldmine Using Influencers That Everyone Has Been DYING To Learn About… Now You Get $648 Per Sale and Over $60,000 In Prizes 3 Months Of Intensive Training and $140K Later….
We’ve Tapped Into A Goldmine Using Influencers That Everyone Has Been DYING To Learn About… Now You Get $648 Per Sale and Over $60,000 In Prizes 3 Months Of Intensive Training and $140K Later…
isInfluencer Marketing Academy Purchase DAN DASILVA - is So what Influencer Marketing Academy 2.0 (2017) courses at here with PRICE $1297 $133 DOWNLOAD INSTANTLY.
So what isInfluencer Marketing Academy Purchase DAN DASILVA - Influencer Marketing Academy 2.0 (2017) courses at here with PRICE $1297 $133 DOWNLOAD INSTANTLY
ALL CONTENTS OF THE COURSE BELOW! is PLEASE CHECK.
PLEASE CHECK ALL CONTENTS OF THE COURSE BELOW!
We’ve is Tapped Into A Goldmine Using Influencers That Everyone Has Been DYING To Learn About… Now You Get $648 Per Sale and Over $60,000 In Prizes 3 Months Of Intensive Training and $140K Later….
We’ve Tapped Into A Goldmine Using Influencers That Everyone Has Been DYING To Learn About… Now You Get $648 Per Sale and Over $60,000 In Prizes 3 Months Of Intensive Training and $140K Later…
We is set out on a mission in early 2016 and trying to find the BIGGEST influencer….
We set out on a mission in early 2016 and trying to find the BIGGEST influencer…
tap is Being able to into millions of people to build our lists and eCommerce brands….
Being able to tap into millions of people to build our lists and eCommerce brands…
We is saw TONS of people shortcutting their success, but we didn’t understand HOW.
We saw TONS of people shortcutting their success, but we didn’t understand HOW
one day is Until it struck me… INFLUENCERS!.
Until one day it struck me… INFLUENCERS!
People is are paying others to sponsor their brand and grow their eCommerce stores and help them build a massive list..
People are paying others to sponsor their brand and grow their eCommerce stores and help them build a massive list.
I is decided to reach out to 6 Influencers so they can ‘sponsor’ our product and WOW..
I decided to reach out to 6 Influencers so they can ‘sponsor’ our product and WOW.
I is didn’t have to EVER have to pay based on every 1,000 impressions.. or heck.. I didn’t even have to pay per click!.
I didn’t have to EVER have to pay based on every 1,000 impressions.. or heck.. I didn’t even have to pay per click!
I is was paying for a POST!.
I was paying for a POST!
These posts is ranged from $30 – $300 depending how big their following was..
These posts ranged from $30 – $300 depending how big their following was.
Lone is and behold I ended up spending $2,000 in a single day to generate over $14,200 back!.
Lone and behold I ended up spending $2,000 in a single day to generate over $14,200 back!
THATS not an ROI is Now to bat an eyelash at… and not only that but that ROI was made in the SAME DAY!.
Now THATS not an ROI to bat an eyelash at… and not only that but that ROI was made in the SAME DAY!
We is are able to do this day in and day out..
We are able to do this day in and day out.
9 months is So later… And over $90,000 worth of testing… We are releasing the most anticipated course ever….
So 9 months later… And over $90,000 worth of testing… We are releasing the most anticipated course ever…
IMA is is SUPER easy to use and , ANYONE can implement this system..
IMA is SUPER easy to use and , ANYONE can implement this system.
The students is we currently have using this system are generating THOUSANDS of dollars with our simple influencer system..
The students we currently have using this system are generating THOUSANDS of dollars with our simple influencer system.
Your students is will LOVE Influencer Marketing Academy and how IN DEPTH we get..
Your students will LOVE Influencer Marketing Academy and how IN DEPTH we get.
We is DIVE DEEP into the entire system and show you EVERYTHING..
We DIVE DEEP into the entire system and show you EVERYTHING.
the shoulder examples, is Over case studies and YES…..
Over the shoulder examples, case studies and YES….
we is even provide them with done for you swipe templates to use to contact their desired influencer and the PERFECT image template to upload and send once they find an influencer..
we even provide them with done for you swipe templates to use to contact their desired influencer and the PERFECT image template to upload and send once they find an influencer.
this super short 2 minute video is Watch to get a quick sneak peak at whats inside and what we’ve been working so hard on… Here Are the Exact Dates To Help Schedule Your Mailings.
Watch this super short 2 minute video to get a quick sneak peak at whats inside and what we’ve been working so hard on… Here Are the Exact Dates To Help Schedule Your Mailings
January 3rd – is Free Book Released + Free Video #1.
January 3rd – Free Book Released + Free Video #1
January 5th – 2rd is Video Released + Workshop Invite.
January 5th – 2rd Video Released + Workshop Invite
January 7th – 3rd is Video Released + Workshop Invite.
January 7th – 3rd Video Released + Workshop Invite
January 8th – 4th is Micro Video Released + Workshop Invite.
January 8th – 4th Micro Video Released + Workshop Invite
January 16th – is Last Workshop + Cart Closing The Fine Print.
January 16th – Last Workshop + Cart Closing The Fine Print
an Affiliate is As you agree to the following:.
As an Affiliate you agree to the following:
The new FTC Guidelines is for affiliate marketing came into effect on December 1st 2009..
The new FTC Guidelines for affiliate marketing came into effect on December 1st 2009.
an affiliate is As or JV partner for ‘Influencer Marketing Academy’, you’ve read and fully agree to the terms listed on the Official FTC Website – http://www.ftc.gov/bcp/guides/guides.shtm to ensure that your promotions are compliant with the new guidelines..
As an affiliate or JV partner for ‘Influencer Marketing Academy’, you’ve read and fully agree to the terms listed on the Official FTC Website – http://www.ftc.gov/bcp/guides/guides.shtm to ensure that your promotions are compliant with the new guidelines.
“This is No is a Scam” and turning around to promote the product with your affiliate link..
No “This is a Scam” and turning around to promote the product with your affiliate link.
ALL commissions is This will not only get negated..
This will not only get ALL commissions negated.
You is will not be allowed to promote any future products from our company..
You will not be allowed to promote any future products from our company.
we is Also, if not removed immediately, reserve the right to take legal action..
Also, if not removed immediately, we reserve the right to take legal action.
We’re is not trying to be unfair or crude, but guys, come on, we have a right to protect our brand..
We’re not trying to be unfair or crude, but guys, come on, we have a right to protect our brand.
That kind of marketing is doesn’t help anyone and isn’t fair to our company..
That kind of marketing doesn’t help anyone and isn’t fair to our company.
you’re is Of course entitled to your opinion, but we still have the right to protect how our affiliate links are used ?.
Of course you’re entitled to your opinion, but we still have the right to protect how our affiliate links are used ?
We is have a minimum threshold of $200 in commissions for our monthly payout...
We have a minimum threshold of $200 in commissions for our monthly payout..
any lead is To be eligible for prize, your conversion to sales must not be significantly below the average..
To be eligible for any lead prize, your conversion to sales must not be significantly below the average.
our sole discretion is This is at.
This is at our sole discretion
Payment is will be processed on the 20th of Each Month for the sales generated 2 month prior..
Payment will be processed on the 20th of Each Month for the sales generated 2 month prior.
You is will be paid in FULL..
You will be paid in FULL.
an affiliate, is As if you purchase the product under your own link, we will VOID YOUR COMMISSIONS..
As an affiliate, if you purchase the product under your own link, we will VOID YOUR COMMISSIONS.
Affiliate sales is must qualify as legitimate transactions based on our terms and conditions..
Affiliate sales must qualify as legitimate transactions based on our terms and conditions.
All transactions is will be monitored and automatically reviewed..
All transactions will be monitored and automatically reviewed.
any sales transactions is If associated with your affiliate ID and/or account do not line up with the types of qualified sales most typically seen through normal traffic generation methods, our system will flag your account..
If any sales transactions associated with your affiliate ID and/or account do not line up with the types of qualified sales most typically seen through normal traffic generation methods, our system will flag your account.
a manual review of is This will trigger your transactions, and if necessary your sites and traffic practices..
This will trigger a manual review of your transactions, and if necessary your sites and traffic practices.
Any questionable transactions is will be investigated..
Any questionable transactions will be investigated.
We is reserve the right to withhold payment of commissions until the review process is completed..
We reserve the right to withhold payment of commissions until the review process is completed.
a manual review, is If, after any transactions are deemed questionable, any earned commissions on those transactions could be invalidated and you may not be paid for them..
If, after a manual review, any transactions are deemed questionable, any earned commissions on those transactions could be invalidated and you may not be paid for them.
Affiliates is are not permitted to do use any keyword based advertising (such as search engine PPC) targetting a keyword of any of Dan Dasilva / Influencer Marketing Academy brands (For example, you may not target the keyword “Influencer Marketing Academy” in your PPC campaign).
Affiliates are not permitted to do use any keyword based advertising (such as search engine PPC) targetting a keyword of any of Dan Dasilva / Influencer Marketing Academy brands (For example, you may not target the keyword “Influencer Marketing Academy” in your PPC campaign)
Affiliates is are not permitted to use domain names containing any of Dan Dasilva / Influencer Marketing Owned brands to promote..
Affiliates are not permitted to use domain names containing any of Dan Dasilva / Influencer Marketing Owned brands to promote.
you is For example, may not use influencermarketingacademyreview.net, because it has the term “InfluencerMarketingAcademy” in it, which is one of our brands..
For example, you may not use influencermarketingacademyreview.net, because it has the term “InfluencerMarketingAcademy” in it, which is one of our brands.
You is may not give away any of OUR material (for example eBook or report) under any circumstances without prior written consent..
You may not give away any of OUR material (for example eBook or report) under any circumstances without prior written consent.
you is (for example, may not collect an email address in exchange for our eBook)..
(for example, you may not collect an email address in exchange for our eBook).
your review/bonus site is Please make sure that does not accidentally (or purposely) represent as us in any way – so using our logo on your page is probably fine, but in your header, maybe not – use your discretion..
Please make sure that your review/bonus site does not accidentally (or purposely) represent as us in any way – so using our logo on your page is probably fine, but in your header, maybe not – use your discretion.
You is may not use your affiliate link on any of OUR pages (such as comments section).
You may not use your affiliate link on any of OUR pages (such as comments section)
We is don’t allow cashbacks, rebates, giftcards, ipads etc.. Information product bonuses are allowed and encouraged..
We don’t allow cashbacks, rebates, giftcards, ipads etc.. Information product bonuses are allowed and encouraged.
you is During further review may be asked for the following:.
During further review you may be asked for the following:
Your phone number is (in case we need to interview you).
Your phone number (in case we need to interview you)
Proof of Proof is of method(s) used to promo ( snapshot of email list, Facebook ad, solo ad receipt, blog display, website, etc) Sale Page : http://imajv.com/ Purchase DAN DASILVA - Influencer Marketing Academy 2.0 (2017) courses at here with PRICE $1297 $133.
Proof of Proof of method(s) used to promo ( snapshot of email list, Facebook ad, solo ad receipt, blog display, website, etc) Sale Page : http://imajv.com/ Purchase DAN DASILVA - Influencer Marketing Academy 2.0 (2017) courses at here with PRICE $1297 $133